Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Holographic Glitter
Blue Jean Haze Ultra Fine
Blue Jean Haze Ultra Fine
Blue Moon Ultra Fine
Blue Moon Ultra Fine
Brownie Sprinkles Ultra Fine
Brownie Sprinkles Ultra Fine
Lady Pirate Ultra Fine
Lady Pirate Ultra Fine
Lavender Shimmer Ultra Fine
Lavender Shimmer Ultra Fine
Mauve Shimmer Ultra Fine
Mauve Shimmer Ultra Fine
Midnight Party Chunky
Midnight Party Chunky
Night Sky Ultra Fine
Night Sky Ultra Fine
Purple Passion Ultra Fine
Purple Passion Ultra Fine
Purple Rain Ultra Fine
Purple Rain Ultra Fine
Red Velvet Ultra Fine
Red Velvet Ultra Fine
Sand Castle Fine
Sand Castle Fine
Teal Dream Ultra Fine
Teal Dream Ultra Fine
Watermelon Blitz Ultra Fine
Watermelon Blitz Ultra Fine
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i